PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00505.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 547aa    MW: 60744.2 Da    PI: 4.2763
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00505.1_g00018.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.35.2e-5291361128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtdeelv +yLk+kv ++++++ ++i+ +d+yk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk
  Rsa1.0_00505.1_g00018.1   9 LAPGFRFHPTDEELVRYYLKRKVCNRPFNF-DAISVTDVYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWK 93 
                              579**************************9.99**************95347777888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +tgkd+e+ + +++ vg+kktLv++kgrap+ge+++Wvmheyrl
  Rsa1.0_00505.1_g00018.1  94 TTGKDREIRN-GSRGVGMKKTLVYHKGRAPRGERSNWVMHEYRL 136
                              *********9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.02E-607159IPR003441NAC domain
PROSITE profilePS5100557.8569159IPR003441NAC domain
PfamPF023655.8E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MGRGSVTSLA PGFRFHPTDE ELVRYYLKRK VCNRPFNFDA ISVTDVYKSE PWDLPDKSKL  60
KSRDLEWYFF SMLDKKYSNG SKTNRATEKG YWKTTGKDRE IRNGSRGVGM KKTLVYHKGR  120
APRGERSNWV MHEYRLTDDE LKKTGAPQDA FVLCRIFQKS GTGPKNGEQY GAPYLEEEWE  180
EDTMTFVPEQ DALLGEGLGV DDDDVYLDID EKPENLVVYD AIPVQTSHCH GESSNNVESG  240
HCEDYIQPGN CVVDSGGYSE QPFEAFEEDQ KPIIRDGSIQ PCSLFPGEQG GCGVEDEDAV  300
NLETSSDNVF VADTCYSDVP IDDASYIPDE PFIDHSNNLP ISDGLQDDFN FEDYLNFLED  360
EDAQDLSLDV SQLLGSEDTL PDQEGLDQKP SPEELEKEVV EKKESGEGSS SKQDADVTDF  420
DSASKYPFLK NMCGVISAPP SFTSQFQTKD AAIRLHAAQS SGSVHVTAGM IRIPNMIADS  480
SMGWSYDKNG NLKVVLSFGL VQGDDAMSST RGKTGGITAT RAILIFMGFW VLLLSVSFKI  540
GTIVSAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-45816516171NAC domain-containing protein 19
4dul_A6e-45816516171NAC domain-containing protein 19
1ut7_B6e-45816516171NO APICAL MERISTEM PROTEIN
1ut7_A6e-45816516171NO APICAL MERISTEM PROTEIN
1ut4_B6e-45816516171NO APICAL MERISTEM PROTEIN
1ut4_A6e-45816516171NO APICAL MERISTEM PROTEIN
3swp_D6e-45816519174NAC domain-containing protein 19
3swp_C6e-45816519174NAC domain-containing protein 19
3swp_B6e-45816519174NAC domain-containing protein 19
3swp_A6e-45816519174NAC domain-containing protein 19
3swm_D6e-45816519174NAC domain-containing protein 19
3swm_C6e-45816519174NAC domain-containing protein 19
3swm_B6e-45816519174NAC domain-containing protein 19
3swm_A6e-45816519174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006398899.10.0hypothetical protein EUTSA_v10013110mg
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLV4LD690.0V4LD69_EUTSA; Uncharacterized protein
STRINGBra009456.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2